Record in detail


General Info

  • lamp_id:L01A001950
  • Name:Sequence 111 from patent US 7001924
  • FullName:Sequence 111 from patent US 7001924
  • Source:Synthetic
  • Mass:9237 Da
  • Sequence Length:74 aa
  • Isoelectric Point:12.24
  • Activity:Antimicrobial
  • Sequence
        ERLRLRRDFLLIFRLGIVVKRKFGKATRRNKLKRWVREIFRRNKGVIDIVVIPRKKLSEEFERVDFWTVREKLL
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001950    From 1 To 74 E-value: 8e-35 Score: 137
        ERLRLRRDFLLIFRLGIVVKRKFGKATRRNKLKRWVREIFRRNKGVIDIVVIPRKKLSEEFERVDFWTVREKLL
  • 2. L01A001912    From 2 To 60 E-value: 0.0000000009 Score: 53.9
        RLLTARQFSAVFRLGLVIGKKNVKLAVQRNRLKRLIRESFRHNQETLDIVVIARKGLGE
  • 3. L01A001940    From 2 To 55 E-value: 0.000000001 Score: 53.5
        RIKKNADFQRIYRLGISVSKKLGNAVLRNKIKRAIRENFKVHKSHIDIIVIARQ
  • 4. L01A001949    From 6 To 54 E-value: 0.000000002 Score: 53.1
        RKQFLYITRMGITVSKKFGKAHERNSFKRVVREVFRHVRHQLQIVVFPK
  • 5. L01A001947    From 2 To 69 E-value: 0.000000005 Score: 51.6
        RLLKRKQFVYVQKVGITVSKKFGKAHQRNRFKRIVREAFRHVRPNLQVVISPRGN-----SQPDFLKLSEELL

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: