Record in detail


General Info

  • lamp_id:L01A001952
  • Name:Sequence 113 from patent US 7001924
  • FullName:Sequence 113 from patent US 7001924
  • Source:Synthetic
  • Mass:8763.4 Da
  • Sequence Length:77 aa
  • Isoelectric Point:12.63
  • Activity:Antimicrobial
  • Sequence
        LRGEREFRKVRRIGLVVSKKTLKHAVKRNRARRRVREALRTMPPELRAILMLNPGVLTVPFPELQAALAQALQRGAG
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001952    From 1 To 77 E-value: 4e-38 Score: 148
        LRGEREFRKVRRIGLVVSKKTLKHAVKRNRARRRVREALRTMPPELRAILMLNPGVLTVPFPELQAALAQALQRGAG
  • 2. L01A001933    From 8 To 69 E-value: 0.0000002 Score: 46.2
        EFQTVFRIGLSVSKK-IGNAVVRNRIKRMIRQILKQNISEIDFVILVRKSVLELKYAELKKSL
  • 3. L01A001912    From 7 To 71 E-value: 0.0000003 Score: 45.4
        RQFSAVFRLGLVIGKKNVKLAVQRNRLKRLIRESFRHNQETLDIVVIARKGLGELENPELHQQFG
  • 4. L01A001937    From 1 To 67 E-value: 0.0000007 Score: 44.7
        VKSDKDFQAIFRVGISVGKK-IGNAVTRNAVKRKIRHVLMELGPYLDFVVIARKGVEELDYSELQQNL
  • 5. L01A001905    From 7 To 71 E-value: 0.0000009 Score: 43.9
        RHFKAVFRLGLVIGKKSVKLAVQRNRLKRLMRDSFRLNQQLLDIVIVARKGLGEIENPELHQHFG

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: