Record in detail


General Info

  • lamp_id:L01A001953
  • Name:Sequence 114 from patent US 7001924
  • FullName:Sequence 114 from patent US 7001924
  • Source:Synthetic
  • Mass:8902.6 Da
  • Sequence Length:75 aa
  • Isoelectric Point:12.18
  • Activity:Antimicrobial
  • Sequence
        ARLKGGFLLLIRVLFTVGKKLVPRAVDRNRIKRLMREAYRLEKNILDHQVMLAFLYRARADAIPSLERFRAIRHM
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001953    From 1 To 75 E-value: 6e-38 Score: 147
        ARLKGGFLLLIRVLFTVGKKLVPRAVDRNRIKRLMREAYRLEKNILDHQVMLAFLYRARADAIPSLERFRAIRHM
  • 2. L01A001880    From 1 To 49 E-value: 0.000000000000003 Score: 72.4
        ARLKGGFL---RVLFTVGKKLVPRAVDRNRIKRLMRE-------LTDHQV---------------LERFRAIRH
  • 3. L01A001908    From 9 To 54 E-value: 0.0000004 Score: 45.4
        FTFVFRIGLTVAKKHVKRAHERNRIKRLTRESFRLHQHALDFVVLV
  • 4. L01A001951    From 5 To 72 E-value: 0.000001 Score: 43.5
        LRDEINTVFSMLVSVAKKRFRRAVKRNRVRRLVREAYRLNKHLLDVLQERQIYATIAFMVVSDELPDF
  • 5. L01A001909    From 9 To 53 E-value: 0.000001 Score: 43.5
        FTFVFRIGLTVAKKNVKRAHERNRIKRLTRESFRLRQHELDFVVV

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: