Record in detail


General Info

  • lamp_id:L01A001999
  • Name:Sequence 14 from patent US 6329504
  • FullName:Sequence 14 from patent US 6329504
  • Source:Synthetic
  • Mass:4425.9 Da
  • Sequence Length:39 aa
  • Isoelectric Point:7.78
  • Activity:Antimicrobial
  • Sequence
        ATCENLANTYRGPCFGGCDFHCKTKEHLLSGRCRDDFRC
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A002571    From 28 To 66 E-value: 4e-19 Score: 85.1
        ATCENLANTYRGPCFGGCDFHCKTKEHLLSGRCRDDFRC
  • 2. L01A001999    From 1 To 39 E-value: 2e-18 Score: 82.8
        ATCENLANTYRGPCFGGCDFHCKTKEHLLSGRCRDDFRC
  • 3. L03A000111    From 29 To 66 E-value: 0.00000000000001 Score: 70.1
        TCENLADKYRGPCFSGCDTHCTTKEHAVSGRCRDDFRC
  • 4. L05ADEF409    From 30 To 69 E-value: 0.00000000000004 Score: 68.6
        TCENLANTYRGPCFTTGSCDDHCKNKEHLRSGRCRDDFRC
  • 5. L01A003067    From 29 To 66 E-value: 0.00000000000007 Score: 67.8
        TCENLADKYRGPCFSGCDTHCTTKENAVSGRCRDDFRC

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: