Record in detail


General Info

  • lamp_id:L01A002000
  • Name:Sequence 2 from patent US 6300489
  • FullName:Sequence 2 from patent US 6300489
  • Source:Synthetic
  • Mass:9353.2 Da
  • Sequence Length:83 aa
  • Isoelectric Point:8.32
  • Activity:Antimicrobial
  • Sequence
        MARSIYFMAFLVLATLFVAYGVQGKEICCKELTKPVKCSSDPLCQKLCMEKEKYEDGHCFTILSKCLCMKRCNAKTLATELLA
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002000    From 1 To 83 E-value: 2.94273e-44 Score: 168
        MARSIYFMAFLVLATLFVAYGVQGKEICCKELTKPVKCSSDPLCQKLCMEKEKYEDGHCFTILSKCLCMKRCNAKTLATELLA
  • 2. L12A04986|    From 1 To 59 E-value: 2e-29 Score: 119
        KEICCKELTKPVKCSSDPLCQKLCMEKEKYEDGHCFTILSKCLCMKRCNAKTLATELLA
  • 3. L12A04987|    From 1 To 59 E-value: 0.000000000000006 Score: 71.2
        KEICCKVPTTPFLCTNDPQCKTLC-SKVNYEDGHCFDILSKCVCMNRCVQDAKTLAAELI
  • 4. L02A000983    From 5 To 50 E-value: 0.000001 Score: 43.9
        CKTTSKHFKGLCFADSKCRKVCIQEDKFEDGHCSKLQRKCLCTKNC
  • 5. L11A012617    From 14 To 47 E-value: 0.000007 Score: 41.2
        CIAKPPCRKACI-REKFTDGHCSKVLRRCLCTKRC

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: