Record in detail


General Info

  • lamp_id:L01A002173
  • Name:Sequence 1104 from patent US 6573361
  • FullName:Sequence 1104 from patent US 6573361
  • Source:Synthetic
  • Mass:9952.6 Da
  • Sequence Length:85 aa
  • Isoelectric Point:10.25
  • Activity:Antimicrobial
  • Sequence
        AEVKIFMVRGTAIFSASRFPTSQKFTKYVRALNEKQAIEYIYSQLGGKNKIKRYNIHIQEIKEVKEDEITDKTIRDLAKLDKIIM
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002173    From 1 To 85 E-value: 2.8026e-45 Score: 171
        AEVKIFMVRGTAIFSASRFPTSQKFTKYVRALNEKQAIEYIYSQLGGKNKIKRYNIHIQEIKEVKEDEITDKTIRDLAKLDKIIM
  • 2. L01A002174    From 1 To 48 E-value: 3e-22 Score: 95.5
        AEVKIFMVRGTAIFSASRFPTSQK---YVRALNEKQAIEYIYSQLGGKNKI
  • 3. L01A002171    From 21 To 73 E-value: 0.0000002 Score: 46.6
        FRKEYKALKPEDALEILYSEFGGRYKVKRSRIKILNIEEIKPEDVTDPVLKKL
  • 4. L01A002172    From 6 To 77 E-value: 0.002 Score: 33.1
        KIFRVKGKFLMGDK----LQPFTKELNAIREEEIYERLYSEFGSKHRVPRSKVKIEEIEEISPEEVQDPVVKALVQ

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: