Record in detail


General Info

  • lamp_id:L01A002175
  • Name:Sequence 1119 from patent US 6573361
  • FullName:Sequence 1119 from patent US 6573361
  • Source:Synthetic
  • Mass:9400 Da
  • Sequence Length:85 aa
  • Isoelectric Point:10.9
  • Activity:Antimicrobial
  • Sequence
        VFYKVTLSRSLIGVPHTTKSIVKSLGLGKRGSIVYKKVNPAIAGSLAKVKELVKVEVTEHELTPSQQRELRKSNPGFIVEKRTID
  • Function:

Cross-Linking

  •   Cross-linking

    •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002175    From 1 To 85 E-value: 4.06377e-44 Score: 167
        VFYKVTLSRSLIGVPHTTKSIVKSLGLGKRGSIVYKKVNPAIAGSLAKVKELVKVEVTEHELTPSQQRELRKSNPGFIVEKRTID
  • 2. L13A020970    From 8 To 29 E-value: 6.1 Score: 21.2
        SLGKVVGKVAIGVAQHYLNPQQ
  • 3. L12A12205|    From 15 To 37 E-value: 6.5 Score: 21.2
        ITPEALEAVLKSNGGAIVNIKTI
  • 4. L13A019561    From 8 To 29 E-value: 7.2 Score: 21.2
        SLGKVVGKVAIGVAQHYLNPQQ

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: