Record in detail


General Info

  • lamp_id:L01A002193
  • Name:Sequence 1202 from patent US 6573361
  • FullName:Sequence 1202 from patent US 6573361
  • Source:Synthetic
  • Mass:8879.4 Da
  • Sequence Length:75 aa
  • Isoelectric Point:12.58
  • Activity:Antimicrobial
  • Sequence
        MNKSKRSSRRRMPPIRSGEIIDYKNISLLRRFVSEQGKILSRRMNRLTSKQQRLLTIAIKRARVLALLPFLNNEN
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002193    From 1 To 75 E-value: 2e-37 Score: 145
        MNKSKRSSRRRMPPIRSGEIIDYKNISLLRRFVSEQGKILSRRMNRLTSKQQRLLTIAIKRARVLALLPFLNNEN
  • 2. L01A002191    From 1 To 74 E-value: 1e-25 Score: 107
        MYKFKRSFRRRLSPIGSGNLIYYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFINNE
  • 3. L01A002190    From 5 To 71 E-value: 1e-19 Score: 87
        RRRLSPLKPNQVIDYQDVELLRTFITDQGKILPRRVTGLTAKQQRAVTKAIKQARVLALLPFVNRES
  • 4. L01A002195    From 5 To 70 E-value: 1e-19 Score: 86.7
        RKKISPIKPTEAVDYKDIDLLRKFITEQGKILPKRSTGLTSKQQKKLTKAIKQARILSLLPFLNKD
  • 5. L01A002304    From 5 To 70 E-value: 1e-17 Score: 80.1
        RKRLSPLPPNQPIDYKDTELLRKFITERGKILPRRITGLTAKQQRDLTTAVKRSRLVALLPFVNKE

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: