Record in detail


General Info

  • lamp_id:L01A002243
  • Name:Sequence 1381 from patent US 6573361
  • FullName:Sequence 1381 from patent US 6573361
  • Source:Synthetic
  • Mass:7321.9 Da
  • Sequence Length:61 aa
  • Isoelectric Point:11.36
  • Activity:Antimicrobial
  • Sequence
        MAKKSMIIKQKRTPKFKVRAYTRCERCGRPHSVYRKFKLCRICFRELAYKGQLPGIKKASW
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002243    From 1 To 61 E-value: 4e-31 Score: 124
        MAKKSMIIKQKRTPKFKVRAYTRCERCGRPHSVYRKFKLCRICFRELAYKGQLPGIKKASW
  • 2. L01A002244    From 1 To 60 E-value: 2e-27 Score: 112
        AKKSMIAKQQRTPKFKVQEYTRCERCGRPHSVIRKFKLCRICFRELAYKGQIPGVKKASW
  • 3. L01A002257    From 1 To 60 E-value: 2e-22 Score: 95.9
        ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW
  • 4. L01A002247    From 1 To 61 E-value: 3e-21 Score: 92
        MAKKSMIAKAQRKPKFQVRAYTRCRICGRPHSVYRDFGLCRVCLRKMGSEGLIPGLRKASW
  • 5. L01A002254    From 1 To 61 E-value: 5e-21 Score: 91.7
        MAKKSLKVKQTRIPKFAVRAYTRCQRCGRARAVLSHFGVCRLCFRELAYAGAIPGVKKASW

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: