Record in detail


General Info

  • lamp_id:L01A002248
  • Name:Sequence 1392 from patent US 6573361
  • FullName:Sequence 1392 from patent US 6573361
  • Source:Synthetic
  • Mass:6192.5 Da
  • Sequence Length:53 aa
  • Isoelectric Point:10.79
  • Activity:Antimicrobial
  • Sequence
        MAKKPWKKKYGYGIRPCQRCGHVGPGLIRKYGLNLCRQCFREIAHKLGFKKLD
  • Function:

Cross-Linking

  •   Cross-linking

    •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002248    From 1 To 53 E-value: 1e-26 Score: 109
        MAKKPWKKKYGYGIRPCQRCGHVGPGLIRKYGLNLCRQCFREIAHKLGFKKLD
  • 2. L01A002250    From 1 To 53 E-value: 3e-17 Score: 78.6
        MTKEPFKTKYGQGSKVCKRCGRKGPGIIRKYGLDLCRQCFRELAPKLGFKKYD
  • 3. L01A002249    From 6 To 50 E-value: 0.0000000007 Score: 54.3
        RKYGKASRKCSRCGD-HSALVRRYGLMLCRQCFRELAPKIGFKKYN
  • 4. L01A001986    From 11 To 55 E-value: 0.000000001 Score: 53.5
        RKFGQGSRSCRVCSNR-HGLIRKYGLNMCRQCFRQYAKDIGFIKLD
  • 5. L01A002244    From 23 To 49 E-value: 0.025 Score: 29.3
        CERCGRPH-SVIRKF--KLCRICFRELAYK

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: