Record in detail


General Info

  • lamp_id:L01A002250
  • Name:Sequence 1394 from patent US 6573361
  • FullName:Sequence 1394 from patent US 6573361
  • Source:Synthetic
  • Mass:6129.3 Da
  • Sequence Length:53 aa
  • Isoelectric Point:10.58
  • Activity:Antimicrobial
  • Sequence
        MTKEPFKTKYGQGSKVCKRCGRKGPGIIRKYGLDLCRQCFRELAPKLGFKKYD
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002250    From 1 To 53 E-value: 8e-26 Score: 107
        MTKEPFKTKYGQGSKVCKRCGRKGPGIIRKYGLDLCRQCFRELAPKLGFKKYD
  • 2. L01A002248    From 1 To 53 E-value: 3e-17 Score: 78.6
        MAKKPWKKKYGYGIRPCQRCGHVGPGLIRKYGLNLCRQCFREIAHKLGFKKLD
  • 3. L01A002249    From 7 To 50 E-value: 0.000000000003 Score: 62
        KYGKASRKCSRCG-DHSALVRRYGLMLCRQCFRELAPKIGFKKYN
  • 4. L01A001986    From 12 To 55 E-value: 0.0000000007 Score: 54.3
        KFGQGSRSCRVCSNR-HGLIRKYGLNMCRQCFRQYAKDIGFIKLD
  • 5. L01A002244    From 23 To 49 E-value: 0.008 Score: 30.8
        CERCGRPH-SVIRKF--KLCRICFRELAYK

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: