Record in detail


General Info

  • lamp_id:L01A002278
  • Name:Sequence 1442 from patent US 6573361
  • FullName:Sequence 1442 from patent US 6573361
  • Source:Synthetic
  • Mass:10228.9 Da
  • Sequence Length:89 aa
  • Isoelectric Point:10.67
  • Activity:Antimicrobial
  • Sequence
        MRMGRVHYPLYRIVAVDSRVKRNGKYIALIGHLNPALKENKCKLDETVALDWLNKGAIPTDTVRSLFSESGLWKKFIESKNKKETSPKK
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002278    From 1 To 89 E-value: 0 Score: 184
        MRMGRVHYPLYRIVAVDSRVKRNGKYIALIGHLNPALKENKCKLDETVALDWLNKGAIPTDTVRSLFSESGLWKKFIESKNKKETSPKK
  • 2. L01A002279    From 1 To 82 E-value: 9.99995e-41 Score: 156
        MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALEWLNKGAKPTDTVRSLFSQTGLWKKFVESKKK
  • 3. L01A002274    From 8 To 89 E-value: 2e-19 Score: 85.9
        RMGAKKSPFYRIVVADSRSPRDGRFIETVGTYNPVAKPAEVKIDEELALKWLQTGAKPSDTVRNLFSSQGIMEKFHNAKQGK
  • 4. L01A002183    From 8 To 79 E-value: 0.0000000002 Score: 56.6
        RYGRKQQPSYRIVAMDSRSKRDGKAIEELGFYNPIT--NETRIDIAKILKRLKQGAQTTRTVKNILNEAQIIAK
  • 5. L01A002184    From 8 To 86 E-value: 0.000000003 Score: 52.4
        RCGRKQRAVYRIVAIDVRSRREGRDLRKVGFYDPI--TNQTYLNLPAILDFLKKGAQPTRTVHDISKKAGIFTELNLNKTK

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: