Record in detail


General Info

  • lamp_id:L01A002298
  • Name:Sequence 1481 from patent US 6573361
  • FullName:Sequence 1481 from patent US 6573361
  • Source:Synthetic
  • Mass:8955.6 Da
  • Sequence Length:77 aa
  • Isoelectric Point:12.3
  • Activity:Antimicrobial
  • Sequence
        MNRPVHNEHRRKRFAKKCPFVSAGWKTIDYKDVVTLKRFITERGKILPRRITGVSSRFQALLAQAVKRARHVGLLLS
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002298    From 1 To 77 E-value: 1.99993e-41 Score: 159
        MNRPVHNEHRRKRFAKKCPFVSAGWKTIDYKDVVTLKRFITERGKILPRRITGVSSRFQALLAQAVKRARHVGLLLS
  • 2. L01A002299    From 5 To 67 E-value: 8e-16 Score: 74.3
        RRRKF---CRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLSLL
  • 3. L01A002297    From 15 To 72 E-value: 0.000000000000003 Score: 72.4
        CYFTSNGITHIDYKDVDLLKKFVSERGKILPRRVTGTNAKYQRKLTAAIKRARQMALL
  • 4. L01A002296    From 14 To 71 E-value: 0.00000000000001 Score: 70.5
        CYFTANNITHIDYKDVDLLKKFISERGKILPRRVTGTSAKYQRKLTVAIKRARQMALL
  • 5. L01A002300    From 5 To 67 E-value: 0.00000000000002 Score: 69.3
        RRRKF---CRFTAENVVEIDYKDIATLKNYISESGKIVPSRITGTRAKYQRQLARAIKRARYLALL

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: