Record in detail


General Info

  • lamp_id:L01A002301
  • Name:Sequence 1486 from patent US 6573361
  • FullName:Sequence 1486 from patent US 6573361
  • Source:Synthetic
  • Mass:10448.2 Da
  • Sequence Length:85 aa
  • Isoelectric Point:10.73
  • Activity:Antimicrobial
  • Sequence
        MERKRYSKRYCKYTEAKISFIDYKDLDMLKHTLSERYKIMPRRLTGNSKKWQERVEVAIKRARHMALIPYIVDRKKVVDSPFKQH
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002301    From 1 To 85 E-value: 0 Score: 175
        MERKRYSKRYCKYTEAKISFIDYKDLDMLKHTLSERYKIMPRRLTGNSKKWQERVEVAIKRARHMALIPYIVDRKKVVDSPFKQH
  • 2. L01A002296    From 14 To 76 E-value: 8e-19 Score: 84
        CYFTANNITHIDYKDVDLLKKFISERGKILPRRVTGTSAKYQRKLTVAIKRARQMALLPYVAD
  • 3. L01A002297    From 15 To 75 E-value: 3e-17 Score: 78.6
        CYFTSNGITHIDYKDVDLLKKFVSERGKILPRRVTGTNAKYQRKLTAAIKRARQMALLPYV
  • 4. L01A002303    From 1 To 71 E-value: 0.000000000000005 Score: 71.2
        MARQSFKRRKFCRFTAEKIQEVDYKQVDLLKDFISENGKIIPARITGTKAFYQRQLAVAVKRARFLALLPY
  • 5. L01A002300    From 7 To 69 E-value: 0.00000000000009 Score: 67.4
        RKFCRFTAENVVEIDYKDIATLKNYISESGKIVPSRITGTRAKYQRQLARAIKRARYLALLPY

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: