Record in detail


General Info

  • lamp_id:L01A002310
  • Name:Sequence 1502 from patent US 6573361
  • FullName:Sequence 1502 from patent US 6573361
  • Source:Synthetic
  • Mass:10687.5 Da
  • Sequence Length:93 aa
  • Isoelectric Point:11.07
  • Activity:Antimicrobial
  • Sequence
        MSRSIKKGPFIDDHLMKKTLKAKEGKDNRPIKTWSRRSTILPEMIGFTYNVHNGRVFIPVYITENHVGYKLGEFAPTRTFKGHKGSVQKKIGK
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002310    From 1 To 93 E-value: 0 Score: 192
        MSRSIKKGPFIDDHLMKKTLKAKEGKDNRPIKTWSRRSTILPEMIGFTYNVHNGRVFIPVYITENHVGYKLGEFAPTRTFKGHKGSVQKKIGK
  • 2. L01A002309    From 2 To 89 E-value: 3e-29 Score: 119
        RSLKKGPFLDLHLLKKVEKAVESGDKKPIKTWSRRSMIIPSMIGLTIAVHNGRQHVPVYVSDEMIGHKLGEFAPTRTYRGHAADKKAK
  • 3. L01A002316    From 1 To 83 E-value: 3e-29 Score: 119
        MARSLKKGPFVADHLLRKVEKLNAKGDKQVIKTWSRASTILPQMIGHTIAVHNGRQHVPVYVTEQMVGHKLGEFAPTRTFRGH
  • 4. L01A002308    From 2 To 82 E-value: 6e-29 Score: 117
        RSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNMIGLTIAVHNGRQHVPVFVTDEMVGHKLGEFAPTRTYRGH
  • 5. L01A002314    From 1 To 83 E-value: 3e-28 Score: 115
        MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFAVHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGH

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: