Record in detail


General Info

  • lamp_id:L01A002326
  • Name:Sequence 1535 from patent US 6573361
  • FullName:Sequence 1535 from patent US 6573361
  • Source:Synthetic
  • Mass:9970.5 Da
  • Sequence Length:87 aa
  • Isoelectric Point:12.11
  • Activity:Antimicrobial
  • Sequence
        MANIKSNEKRLRQNIKRNLNNKGQKTKLKTNVKNFHKEINLDNLGNVYSQADRLARKGIISTNRARRLKSRNVAVLNKTQVTAVEGK
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002326    From 1 To 87 E-value: 2.94273e-44 Score: 168
        MANIKSNEKRLRQNIKRNLNNKGQKTKLKTNVKNFHKEINLDNLGNVYSQADRLARKGIISTNRARRLKSRNVAVLNKTQVTAVEGK
  • 2. L01A002324    From 1 To 87 E-value: 1e-32 Score: 130
        MANIKSNEKRLRQDIKRNLNNKGQKTKLKTNVKKFNKEINLDNLSSVYSQADRLARKGIISLNRAKRLKSKNAVILHKSNTNSTAKK
  • 3. L01A002323    From 1 To 78 E-value: 0.00006 Score: 38.1
        MANHKSAEKRIRQTIKRTERNRFYKTKIKNIIKAVREAVAVNDVAKAQERLKIANKELHKFVSKGILKKNTASRKVSR
  • 4. L01A002322    From 1 To 84 E-value: 0.00007 Score: 37.7
        ANIKSAKKRAVQSEKRRQHNASQRSMMRTYIKKVYAQVAAGEKSAAEAAFVEMQKVVDRMASKGLIHANKAANHKSKLAAQIKK
  • 5. L01A002211    From 1 To 85 E-value: 0.0001 Score: 37
        MANTKSAIKRIK-TIERNRIRNCAYKSVVKTFIKKYLKVLSDYTNAPNSNGVENIQTTLGIVYTKIDKAVKRGVYHSNKAARMKSK

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: