Record in detail


General Info

  • lamp_id:L01A002335
  • Name:Sequence 1546 from patent US 6573361
  • FullName:Sequence 1546 from patent US 6573361
  • Source:Synthetic
  • Mass:8330.5 Da
  • Sequence Length:70 aa
  • Isoelectric Point:11.51
  • Activity:Antimicrobial
  • Sequence
        PVIKVRENESFDVALRRFKRSCEKAGILAEVRAREFYEKPTTIRKRENATLAKRHAKRNARENARNTRLY
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002335    From 1 To 70 E-value: 4e-35 Score: 138
        PVIKVRENESFDVALRRFKRSCEKAGILAEVRAREFYEKPTTIRKRENATLAKRHAKRNARENARNTRLY
  • 2. L01A002334    From 1 To 70 E-value: 2e-27 Score: 112
        PVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKASAVKRHAKKLARENARRTRLY
  • 3. L01A002332    From 4 To 59 E-value: 0.000000000001 Score: 63.9
        ILLKENEPFEVAIRRFRRAIEKNGLIAELRERQAYEKPTAVRKRKKAAAVKRLHKR
  • 4. L01A002330    From 5 To 54 E-value: 0.00000000004 Score: 58.5
        VRKNESIDDALRRFKRAVSKTGTLQEVRKREFYEKPSVRRKKKSEAARKR
  • 5. L01A002339    From 2 To 42 E-value: 0.0000000001 Score: 56.6
        PGIRVKEGESIESALKRFKKATEKAGILSEIRKREHYEKPS

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: