Record in detail


General Info

  • lamp_id:L01A002336
  • Name:Sequence 1547 from patent US 6573361
  • FullName:Sequence 1547 from patent US 6573361
  • Source:Synthetic
  • Mass:8613.1 Da
  • Sequence Length:70 aa
  • Isoelectric Point:11.35
  • Activity:Antimicrobial
  • Sequence
        MPGIKVREGDAFDEAYRRFKKQTDRNLVVTECRARRFFESKTEKRKKQKISAKKKVLKRLYMLRRYESRL
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002336    From 1 To 70 E-value: 2e-35 Score: 139
        MPGIKVREGDAFDEAYRRFKKQTDRNLVVTECRARRFFESKTEKRKKQKISAKKKVLKRLYMLRRYESRL
  • 2. L01A002334    From 1 To 59 E-value: 0.00000001 Score: 50.1
        PVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKASAVKRHAKKL
  • 3. L01A002335    From 1 To 58 E-value: 0.00000005 Score: 48.1
        PVIKVRENESFDVALRRFKRSCEKAGILAEVRAREFYEKPTTIRKRENATLAKRHAKR
  • 4. L01A002339    From 1 To 39 E-value: 0.000001 Score: 43.9
        MPGIRVKEGESIESALKRFKKATEKAGILSEIRKREHYE
  • 5. L01A002332    From 1 To 60 E-value: 0.000002 Score: 42.7
        MTTILLKENEPFEVAIRRFRRAIEKNGLIAELRERQAYEKPTAVRKRKKAAAVKRLHKRL

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: