Record in detail


General Info

  • lamp_id:L01A002339
  • Name:Sequence 1550 from patent US 6573361
  • FullName:Sequence 1550 from patent US 6573361
  • Source:Synthetic
  • Mass:7351.7 Da
  • Sequence Length:64 aa
  • Isoelectric Point:11.51
  • Activity:Antimicrobial
  • Sequence
        MPGIRVKEGESIESALKRFKKATEKAGILSEIRKREHYEKPSVKRKKKALAAKKRAVKKARKSF
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002339    From 1 To 64 E-value: 2e-29 Score: 119
        MPGIRVKEGESIESALKRFKKATEKAGILSEIRKREHYEKPSVKRKKKALAAKKRAVKKARKSF
  • 2. L01A002330    From 5 To 54 E-value: 0.0000000000004 Score: 65.1
        VRKNESIDDALRRFKRAVSKTGTLQEVRKREFYEKPSVRRKKKSEAARKR
  • 3. L01A002335    From 1 To 63 E-value: 0.000000000001 Score: 63.5
        PVIKVRENESFDVALRRFKRSCEKAGILAEVRAREFYEKPTTIRKRENATLAKRHAKRNAREN
  • 4. L01A002334    From 1 To 63 E-value: 0.000000000002 Score: 62.8
        PVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKASAVKRHAKKLAREN
  • 5. L01A002331    From 5 To 54 E-value: 0.000000000002 Score: 62.8
        VRKNESLEDALRRFKRSVSKTGTLQEARKREFYEKPSVKRKKKSEAARKR

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: