Record in detail


General Info

  • lamp_id:L01A002380
  • Name:PEN4C_LITVA
  • FullName:Penaeidin-4c
  • Source:Litopenaeus vannamei
  • Mass:5314.1 Da
  • Sequence Length:47 aa
  • Isoelectric Point:8.85
  • Activity:Antibacterial, Antifungal
  • Sequence
        YSSGYTRPLPKPSRPIFIRPIGCDVCYGIPSSTARLCCFRYGDCCHR
  • Function:Antibacterial and antifungal activity. Presents chitin-binding activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A09148|    From 20 To 66 E-value: 8e-23 Score: 97.4
        YSSGYTRPLPKPSRPIFIRPIGCDVCYGIPSSTARLCCFRYGDCCHR
  • 2. L12A09125|    From 20 To 66 E-value: 2e-22 Score: 95.9
        HSSGYTRPLPKPSRPIFIRPIGCDVCYGIPSSTARLCCFRYGDCCHR
  • 3. L01A002380    From 1 To 47 E-value: 3e-22 Score: 95.5
        YSSGYTRPLPKPSRPIFIRPIGCDVCYGIPSSTARLCCFRYGDCCHR
  • 4. L12A09151|    From 20 To 65 E-value: 6e-22 Score: 94.4
        HSSGYTRPLPKPSRPIFIRPIGCDVCYGIPSSTARLCCFRYGDCCH
  • 5. L01A002669    From 1 To 47 E-value: 6e-22 Score: 94.4
        HSSGYTRPLPKPSRPIFIRPIGCDVCYGIPSSTARLCCFRYGDCCHR

Structure

  •   Domains
  •   1  Name:Penaeidin    Interpro Link:IPR009226
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Gross P.S.,Chapman R.W.,Shepard E.F.,Cuthbertson B.J.,
  •   Title:Diversity of the penaeidin antimicrobial peptides in two shrimp species.
  •   Journal:Immunogenetics, 2002, 54, 442-445  [MEDLINE:22226701]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: