Record in detail
General Info
- lamp_id:L01A002383
- Name:CEC4_BOMMO
- FullName:Cecropin
- Source:Bombyx mori
- Mass:3762.5 Da
- Sequence Length:35 aa
- Isoelectric Point:11.34
- Activity:Antibacterial
- Sequence
RWKIFKKIEKVGQNIRDGIVKAGPAVAVVGQAATI - Function:Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria.
Cross-Linking
- Cross-linking
- 1 Database:APD 125
- 2 Database:CAMP CAMPSQ1241
- 3 Database:DBAASP 3460
- 4 Database:dbAMP dbAMP_10858
- 5 Database:DRAMP DRAMP03538
- 6 Database:SATPdb satpdb23843
- 7 Database:Uniprot P14666
- 8 Database:AMD CEC4_BOMMO
- 9 Database:RAP RAPD0072
- 10 Database:RAP RAPD0084
- 11 Database:RAP RAPD0093
- 12 Database:RAP RAPD0150
- 13 Database:RAP RAPD0157
- 14 Database:RAP RAPD0158
- 15 Database:RAP RAPD0172
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A002643 From 27 To 61 E-value: 0.00000000000002 Score: 69.7
RWKIFKKIEKVGQNIRDGIIKAGPAVAVVGQAATI - 2. L01A002383 From 1 To 35 E-value: 0.00000000000003 Score: 68.6
RWKIFKKIEKVGQNIRDGIVKAGPAVAVVGQAATI - 3. L03A000235 From 25 To 59 E-value: 0.0000000000001 Score: 67
RWKFFKKIEKVGQNIRDGIIKAGPAVAVVGQAASI - 4. L12A08526| From 25 To 59 E-value: 0.0000000000001 Score: 67
RWKIFKKIEKVGRNVRDGIIKAGPAVAVVGQAATV - 5. L01A003759 From 1 To 35 E-value: 0.0000000000002 Score: 65.9
RWKFFKKIEKVGQNIRDGIIKAGPAVAVVGQAASI
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Hultmark D.,Boman H.G.,
- Title:Cell-free immunity in insects.
- Journal:Annu. Rev. Microbiol., 1987, 41, 103-126 [MEDLINE:88075837]
Comments
- Comments
No comments found on LAMP database