Record in detail
General Info
- lamp_id:L01A002387
- Name:ANDP_DROMA
- FullName:Andropin
- Source:Drosophila mauritiana
- Mass:3717.5 Da
- Sequence Length:34 aa
- Isoelectric Point:9.32
- Activity:Antibacterial
- Sequence
VFIDILDKMENAIHKAAQAGIGIAKPIEKMILPK - Function:Male-specific peptide with moderate activity against Gram-positive bacteria.
Cross-Linking
- Cross-linking
- 1 Database:APD 343
- 2 Database:CAMP CAMPSQ1245
- 3 Database:dbAMP dbAMP_11719
- 4 Database:DRAMP DRAMP03110
- 5 Database:SATPdb satpdb21688
- 6 Database:Uniprot O16825
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A002387 From 1 To 34 E-value: 0.00000000000007 Score: 67.8
VFIDILDKMENAIHKAAQAGIGIAKPIEKMILPK - 2. L01A002906 From 1 To 34 E-value: 0.0000000000002 Score: 66.6
VFIDILDKMENAIHKAAQAGIGIAKPIENMILPK - 3. L03A000192 From 24 To 57 E-value: 0.0000000000002 Score: 66.6
VFIDILDKMENAIHKAAQAGIGIAKPIENMILPK - 4. L03A000194 From 24 To 57 E-value: 0.0000000000003 Score: 65.9
VFIDILDKMENAIHKAAQAGIGLAKPIENMILPK - 5. L01A002905 From 1 To 34 E-value: 0.0000000000004 Score: 65.5
VFIDILDKMENAIHKAAQAGIGLAKPIENMILPK
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Wang L.,Clark A.G.,
- Title:Molecular population genetics of Drosophila immune system genes.
- Journal:Genetics, 1997, 147, 713-724 [MEDLINE:97476321]
- [2] Aguade M.,Ramos-Onsins S.,
- Title:Molecular evolution of the Cecropin multigene family in Drosophila: functional genes vs pseudogenes.
- Journal:Genetics, 1998, 150, 157-171 [MEDLINE:98393576]
- [3] Chigusa S.I.,Sawai H.,Kasahara K.,Date-Ito A.,
- Title:Rapid evolution of the male-specific antibacterial protein andropin gene in Drosophila.
- Journal:J. Mol. Evol., 2002, 54, 665-670 [MEDLINE:21962106]
Comments
- Comments
No comments found on LAMP database