Record in detail
General Info
- lamp_id:L01A002391
- Name:CE3G_HYPCU
- FullName:Hyphancin-3G
- Source:Hyphantria cunea
- Mass:3843.6 Da
- Sequence Length:35 aa
- Isoelectric Point:11.77
- Activity:Antibacterial
- Sequence
RWKVFKKIEKVGRHIRDGVIKAGPAITVVGQATAL - Function:Has antibacterial activity.
Cross-Linking
- Cross-linking
- 1 Database:APD 349
- 2 Database:CAMP CAMPSQ1249
- 3 Database:dbAMP dbAMP_10866
- 4 Database:DRAMP DRAMP03505
- 5 Database:SATPdb satpdb18687
- 6 Database:Uniprot P50723
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L03A000215 From 27 To 61 E-value: 0.000000000000004 Score: 72
RWKVFKKIEKVGRHIRDGVIKAGPAITVVGQATAL - 2. L01A002391 From 1 To 35 E-value: 0.00000000000001 Score: 70.1
RWKVFKKIEKVGRHIRDGVIKAGPAITVVGQATAL - 3. L03A000216 From 27 To 61 E-value: 0.0000000000004 Score: 65.5
RWKVFKKIEKVGRNIRDGVIKAGPAIAVVGQAKAL - 4. L01A002390 From 1 To 35 E-value: 0.0000000000008 Score: 63.9
RWKVFKKIEKVGRNIRDGVIKAGPAIAVVGQAKAL - 5. L12A08749| From 27 To 61 E-value: 0.000000000002 Score: 62.8
RWKVFKKIEKVGRNIRDGVIKAGPAIEVLGQAKAI
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
No references found on LAMP database
Comments
- Comments
No comments found on LAMP database