Record in detail
General Info
- lamp_id:L01A002392
- Name:CECE_BOMMO
- FullName:Antibacterial peptide enbocin
- Source:Bombyx mori
- Mass:3882.4 Da
- Sequence Length:37 aa
- Isoelectric Point:11.3
- Activity:Antibacterial
- Sequence
PWNIFKEIERAVARTRDAVISAGPAVRTVAAATSVAS - Function:Has antibacterial activity against Gram-positive and Gram-negative bacteria.
Cross-Linking
- Cross-linking
- 1 Database:APD 350
- 2 Database:CAMP CAMPSQ1250
- 3 Database:dbAMP dbAMP_10021
- 4 Database:DRAMP DRAMP03534
- 5 Database:SATPdb satpdb21710
- 6 Database:Uniprot P48821
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L03A000224 From 22 To 58 E-value: 0.000000000000002 Score: 72.4
PWNIFKEIERAVARTRDAVISAGPAVRTVAAATSVAS - 2. L01A002392 From 1 To 37 E-value: 0.000000000000005 Score: 71.6
PWNIFKEIERAVARTRDAVISAGPAVRTVAAATSVAS - 3. L03A000223 From 22 To 45 E-value: 0.000000002 Score: 53.1
PWNIFKEIERAVARTRDAVISAGP - 4. L12A08764| From 22 To 45 E-value: 0.000000003 Score: 52
PWNFFKEIERAVARTRDAVISAGP - 5. L12A08763| From 22 To 45 E-value: 0.000000003 Score: 52
PWNFFKEIERAVARTRDAVISAGP
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
No references found on LAMP database
Comments
- Comments
No comments found on LAMP database