Record in detail
General Info
- lamp_id:L01A002394
- Name:VIRE_HELVI
- FullName:Virescein
- Source:Heliothis virescens
- Mass:4389.2 Da
- Sequence Length:41 aa
- Isoelectric Point:11.56
- Activity:Antibacterial
- Sequence
GKIPIGAIKKAGKAIGKGLRAVNIASTAHDVYTFFKPKKRH - Function:Has antibacterial activity against Gram-positive and Gram-negative bacteria.
Cross-Linking
- Cross-linking
- 1 Database:APD 372
- 2 Database:CAMP CAMPSQ1252
- 3 Database:dbAMP dbAMP_03208
- 4 Database:DRAMP DRAMP03500
- 5 Database:SATPdb satpdb12053
- 6 Database:Uniprot P83416
- 7 Database:AMD VIRE_HELVI
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L12A07894| From 25 To 65 E-value: 2e-18 Score: 82.8
GKIPIGAIKKAGKAIGKGLRAVNIASTAHDVYTFFKPKKRH - 2. L01A002394 From 1 To 41 E-value: 5e-18 Score: 81.3
GKIPIGAIKKAGKAIGKGLRAVNIASTAHDVYTFFKPKKRH - 3. L12A07895| From 25 To 65 E-value: 7e-18 Score: 80.9
GKIPVGAIKKAGRAIGKGLRAINIASTAHDVYTFFKPKKRH - 4. L01A003197 From 1 To 38 E-value: 0.00000000000005 Score: 68.2
GKIPVKAIKKAGAAIGKGLRAINIASTAHDVYSFFKPK - 5. L03A000230 From 25 To 64 E-value: 0.000000000001 Score: 63.9
AKIPIKAIKTVGKAVGKGLRAINIASTANDVFNFLKPKKR
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
No references found on LAMP database
Comments
- Comments
No comments found on LAMP database