Record in detail
General Info
- lamp_id:L01A002398
- Name:CECB1_AEDAL
- FullName:Cecropin-B type 1
- Source:Aedes albopictus
- Mass:3642.4 Da
- Sequence Length:35 aa
- Isoelectric Point:11.04
- Activity:Antibacterial
- Sequence
GGLKKLGKKLEGVGKRVFKASEKALPVLTGYKAIG - Function:Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria (By similarity).
Cross-Linking
- Cross-linking
- 1 Database:APD 133
- 2 Database:CAMP CAMPSQ1256
- 3 Database:dbAMP dbAMP_02741
- 4 Database:DRAMP DRAMP03131
- 5 Database:SATPdb satpdb10158
- 6 Database:Uniprot Q9Y0Y0
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L03A000204 From 25 To 59 E-value: 0.0000000000002 Score: 66.6
GGLKKLGKKLEGVGKRVFKASEKALPVLTGYKAIG - 2. L03A000211 From 25 To 59 E-value: 0.0000000000002 Score: 66.2
GGLKKLGKKLEGVGKRVFKASEKALPVLTGYKAIG - 3. L12A02742| From 1 To 35 E-value: 0.0000000000003 Score: 65.5
GGLKKLGKKLEGVGKRVFKASEKALPVLTGYKAIG - 4. L01A002398 From 1 To 35 E-value: 0.0000000000003 Score: 65.5
GGLKKLGKKLEGVGKRVFKASEKALPVLTGYKAIG - 5. L12A08725| From 24 To 58 E-value: 0.000000000004 Score: 62
GGLKKFGKKLEGVGKRVFKASEKALPVVTGFKALG
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Fallon A.M.,Eccleston E.D.,Sun D.,
- Title:Cloning and expression of three cecropin cDNAs from a mosquito cell line.
- Journal:FEBS Lett., 1999, 454, 147-151 [MEDLINE:99339458]
Comments
- Comments
No comments found on LAMP database