Record in detail


General Info

  • lamp_id:L01A002400
  • Name:beta-defensin 1
  • FullName:beta-defensin 1
  • Source:Oncorhynchus mykiss (rainbow trout)
  • Mass:6501.8 Da
  • Sequence Length:60 aa
  • Isoelectric Point:5.6
  • Activity:Antibacterial
  • Sequence
        MVTLVLLVFLLLNVVEDEAASFPFSCPTLSGVCRKLCLPTEMFFGPLGCGKGFLCCVSHF
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002400    From 1 To 60 E-value: 3e-29 Score: 118
        MVTLVLLVFLLLNVVEDEAASFPFSCPTLSGVCRKLCLPTEMFFGPLGCGKGFLCCVSHF
  • 2. L12A08992|    From 19 To 70 E-value: 3e-22 Score: 95.5
        FGLTIVVQNEAASFPFSCPTLSGVCRKVCLPTEMFFGPLGCGKGFLCCVSHF
  • 3. L12A01472|    From 1 To 45 E-value: 3e-20 Score: 89
        ENEAVSFPWSCPTLSGVCRKVCLPTEMFFGPLGCGKGFLCCVSHF
  • 4. L12A00551|    From 1 To 41 E-value: 5e-19 Score: 84.7
        ASFPFSCPTLSGVCRKLCLPTEMFFGPLGCGKGFLCCVSHF
  • 5. L12A00559|    From 1 To 41 E-value: 2e-17 Score: 79.3
        ASFPWTCPSLSGVCRKVCLPTEMFFGPLGCGKGFQCCVSHF

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: