Record in detail
General Info
- lamp_id:L01A002410
- Name:CECD_BOMMO
- FullName:Cecropin-D
- Source:Bombyx mori
- Mass:3817.4 Da
- Sequence Length:36 aa
- Isoelectric Point:10.33
- Activity:Antibacterial
- Sequence
GNFFKDLEKMGQRVRDAVISAAPAVDTLAKAKALGQ - Function:Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria.
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ1266
- 2 Database:dbAMP dbAMP_03896
- 3 Database:DRAMP DRAMP03531
- 4 Database:Uniprot O76146
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A002410 From 1 To 36 E-value: 0.000000000000001 Score: 73.2
GNFFKDLEKMGQRVRDAVISAAPAVDTLAKAKALGQ - 2. L12A08753| From 25 To 60 E-value: 0.000000001 Score: 53.9
GNFFKDLEGIGQRVRDAIESAGPAVDVLGRAAALSR - 3. L01A000175 From 2 To 34 E-value: 0.000000001 Score: 53.1
NFFKEIERAGQRIRDAIISAAPAVETLAQAQKI - 4. L12A08848| From 23 To 55 E-value: 0.000000005 Score: 51.6
DFFKELEGAGQRVRDAIISAGPAVDVLTKAKGL - 5. L12A08847| From 23 To 57 E-value: 0.000000007 Score: 51.2
DLFKEIEGVGQRVRDAVISAGPAVDVLAKAKNLAR
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Taniai K.,Ishibashi J.,Sagisaka A.,Furukawa S.,Yang J.,
- Title:cDNA cloning and gene expression of cecropin D, an antibacterial protein in the silkworm, Bombyx mori.
- Journal:Comp. Biochem. Physiol., 1999, 122, 409-414 [MEDLINE:99320750]
Comments
- Comments
No comments found on LAMP database