Record in detail


General Info

  • lamp_id:L01A002412
  • Name:CECA1_DROSI
  • FullName:Cecropin-A1
  • Source:Drosophila simulans
  • Mass:4584.2 Da
  • Sequence Length:43 aa
  • Isoelectric Point:11.2
  • Activity:Antibacterial
  • Sequence
        QSEAGWLKKIGKKIERVGQHTRDATIQGLGVAQQAPNVAATAR
  • Function:Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002412    From 1 To 43 E-value: 1e-19 Score: 87
        QSEAGWLKKIGKKIERVGQHTRDATIQGLGVAQQAPNVAATAR
  • 2. L03A000228    From 20 To 62 E-value: 5e-19 Score: 84.7
        QSEAGWLKKIGKKIERVGQHTRDATIQGLGIAQQAANVAATAR
  • 3. L12A08769|    From 20 To 62 E-value: 5e-19 Score: 84.7
        QSEAGWLKKIGKKIERVGQHTRDATIQGLGIAQQAANVAATAR
  • 4. L01A002411    From 13 To 55 E-value: 8e-19 Score: 84
        QSEAGWLKKIGKKIERVGQHTRDATIQGLGIAQQAANVAATAR
  • 5. L03A000209    From 20 To 62 E-value: 1e-18 Score: 83.2
        QSQAGWLKKIGKKIERVGQHTRDATIQGLGIAQQAANVAATAR

Structure

  •   Domains
  •   1  Name:Cecropin    Interpro Link:IPR000875
  •   2  Name:Cecropin_diptera    Interpro Link:IPR020400
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Chigusa S.I.,Takahata N.,Satta Y.,Date A.,
  •   Title:Evolutionary history and mechanism of the Drosophila cecropin gene family.
  •   Journal:Immunogenetics, 1998, 47, 417-429  [MEDLINE:98221115]
  •   [2]  Aguade M.,Ramos-Onsins S.,
  •   Title:Molecular evolution of the Cecropin multigene family in Drosophila: functional genes vs pseudogenes.
  •   Journal:Genetics, 1998, 150, 157-171  [MEDLINE:98393576]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: