Record in detail


General Info

  • lamp_id:L01A002420
  • Name:Beta-defensin 2
  • FullName:Beta-defensin 2
  • Source:Macaca mulatta (rhesus monkey)
  • Mass:3908.7 Da
  • Sequence Length:36 aa
  • Isoelectric Point:8.88
  • Activity:Antibacterial
  • Sequence
        DPVTCLKNGAICHPVFCPRRYKQIGTCGLPGTKCCK
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000299    From 27 To 62 E-value: 1e-16 Score: 77
        DPVTCLKNGAICHPVFCPRRYKQIGTCGLPGTKCCK
  • 2. L01A002420    From 1 To 36 E-value: 3e-16 Score: 75.9
        DPVTCLKNGAICHPVFCPRRYKQIGTCGLPGTKCCK
  • 3. L05ADEF127    From 4 To 39 E-value: 3e-16 Score: 75.5
        DPVTCLKNGAICHPVFCPRRYKQIGTCGLPGTKCCK
  • 4. L01A001370    From 27 To 62 E-value: 6e-16 Score: 74.7
        DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCK
  • 5. L01A001369    From 27 To 62 E-value: 7e-16 Score: 74.3
        DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCK

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: