Record in detail


General Info

  • lamp_id:L01A002421
  • Name:beta defensin-6-like antimicrobial peptide
  • FullName:beta defensin-6-like antimicrobial peptide
  • Source:Anas platyrhynchos
  • Mass:3759.3 Da
  • Sequence Length:36 aa
  • Isoelectric Point:8.64
  • Activity:Antimicrobial
  • Sequence
        DTLACRQSHGSCSFVACRAPSVDIGTCRGGKLKCCK
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF298    From 27 To 62 E-value: 2e-16 Score: 76.6
        DTLACRQSHGSCSFVACRAPSVDIGTCRGGKLKCCK
  • 2. L07APD0081    From 2 To 37 E-value: 6e-16 Score: 74.3
        DTLACRQSHGSCSFVACRAPSVDIGTCRGGKLKCCK
  • 3. L12A09035|    From 27 To 62 E-value: 7e-16 Score: 74.3
        DTLACRQGHGSCSFVACRAPSVDIGTCRGGKLKCCK
  • 4. L02A001146    From 1 To 36 E-value: 7e-16 Score: 74.3
        DTLACRQSHGSCSFVACRAPSVDIGTCRGGKLKCCK
  • 5. L01A002421    From 1 To 36 E-value: 0.000000000000001 Score: 73.9
        DTLACRQSHGSCSFVACRAPSVDIGTCRGGKLKCCK

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: