Record in detail


General Info

  • lamp_id:L01A002430
  • Name:antimicrobial peptide MGD2b
  • FullName:antimicrobial peptide MGD2b
  • Source:Mytilus galloprovincialis (Mediterranean mussel)
  • Mass:9306.8 Da
  • Sequence Length:82 aa
  • Isoelectric Point:7.61
  • Activity:Antimicrobial
  • Sequence
        MKAVFVLLVVGLCIMMMDVATAGFGCPNNYACHQHCKSIRGYCGGYCASWFRLRCTCYRCGGRRDDVEDIFDIYDNVAVERF
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002430    From 1 To 82 E-value: 8.40779e-45 Score: 170
        MKAVFVLLVVGLCIMMMDVATAGFGCPNNYACHQHCKSIRGYCGGYCASWFRLRCTCYRCGGRRDDVEDIFDIYDNVAVERF
  • 2. L12A02572|    From 1 To 60 E-value: 1e-25 Score: 106
        GFGCPNNYQCHRHCKSIPGRCGGYCGGWHRLRCTCYRCGGRREDVEDIFDIFDNEAADRF
  • 3. L02A000711    From 1 To 39 E-value: 7e-19 Score: 84.3
        GFGCPNNYACHQHCKSIRGYCGGYCAGWFRLRCTCYRCG
  • 4. L03A000031    From 1 To 39 E-value: 0.000000000000005 Score: 71.6
        GFGCPNNYQCHRHCKSIPGRCGGYCGGWHRLRCTCYRCG
  • 5. L01A003021    From 1 To 38 E-value: 0.00000000000002 Score: 69.7
        GFGCPNNYQCHRHCKSIPGRCGGYCGGWHRLRCTCYRC

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: