Record in detail


General Info

  • lamp_id:L01A002432
  • Name:sperm associated antigen 11 isoform C
  • FullName:sperm associated antigen 11 isoform C
  • Source:Pan troglodytes (chimpanzee)
  • Mass:6171 Da
  • Sequence Length:53 aa
  • Isoelectric Point:5.74
  • Activity:Antimicrobial
  • Sequence
        DLLPPRTPPYQEPASDLKVVDFRRSEGFCQEYCNYMETQVGYCPKKKDACCLH
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002432    From 1 To 53 E-value: 2e-27 Score: 112
        DLLPPRTPPYQEPASDLKVVDFRRSEGFCQEYCNYMETQVGYCPKKKDACCLH
  • 2. L01A000194    From 6 To 53 E-value: 7e-18 Score: 80.9
        RIPYYPEVESDLRIVDCKRSEGFCQEYCNYLETQVGYCSKKKDACCLH
  • 3. L01A002500    From 1 To 32 E-value: 0.0000000000003 Score: 65.9
        VDCRRSEGFCQEYCNYMETQVGYCSKKKDACC
  • 4. L01A002596    From 1 To 34 E-value: 0.0000000000003 Score: 65.5
        RIVDCKRSEGFCQEYCNYLETQVGYCSKKKDACC
  • 5. L01A002555    From 1 To 34 E-value: 0.00000000005 Score: 58.2
        QIVNCKKNEGFCQKYCNFMETQVGYCSKKKEACC

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: