Record in detail


General Info

  • lamp_id:L01A002451
  • Name:OPO4_OPICA
  • FullName:Opistoporin-4
  • Source:Opistophthalmus carinatus
  • Mass:4797.5 Da
  • Sequence Length:44 aa
  • Isoelectric Point:10.7
  • Activity:Antibacterial, Antifungal
  • Sequence
        GKVWDWIKKTAKDVLNSDVAKQLKNKALNAAKNFVAEKIGATPS
  • Function:At high concentrations, acts as pore former in cellular membranes and causes the leakage of the cells. At submicromolar concentrations, degranulates granulocytes and has a weak hemolytic activity against human red blood cells. Also strongly inhibits the production of superoxide anions. Has a strong antibacterial activity against Gram-negative bacteria but is less active against Gram-positive bacteria. Also has antifungal activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002451    From 1 To 44 E-value: 2e-19 Score: 86.3
        GKVWDWIKKTAKDVLNSDVAKQLKNKALNAAKNFVAEKIGATPS
  • 2. L12A08779|    From 24 To 65 E-value: 0.000000000000004 Score: 71.6
        VWDWLKKTAKNVWNSDIVKQLKGKAINAAKNYVAEKIGATPS
  • 3. L13A011887    From 2 To 43 E-value: 0.000000000000008 Score: 70.9
        VWDWLKKTAKNVWNSDIVKQLKGKAINAAKNYVAEKIGATPS
  • 4. L01A000338    From 1 To 44 E-value: 0.00000000000002 Score: 69.7
        GKVWDWIKSTAKKLWNSEPVKELKNTALNAAKNFVAEKIGATPS
  • 5. L12A08840|    From 23 To 66 E-value: 0.00000000000004 Score: 68.6
        GKVWDWIKSTAKKLWNSEPVKELKNTALNAAKNLVAEKIGATPS

Structure

  •   Domains
  •   1  Name:Antimicrobial_7    Interpro Link:IPR012526
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: