Record in detail
General Info
- lamp_id:L01A002451
- Name:OPO4_OPICA
- FullName:Opistoporin-4
- Source:Opistophthalmus carinatus
- Mass:4797.5 Da
- Sequence Length:44 aa
- Isoelectric Point:10.7
- Activity:Antibacterial, Antifungal
- Sequence
GKVWDWIKKTAKDVLNSDVAKQLKNKALNAAKNFVAEKIGATPS - Function:At high concentrations, acts as pore former in cellular membranes and causes the leakage of the cells. At submicromolar concentrations, degranulates granulocytes and has a weak hemolytic activity against human red blood cells. Also strongly inhibits the production of superoxide anions. Has a strong antibacterial activity against Gram-negative bacteria but is less active against Gram-positive bacteria. Also has antifungal activity (By similarity).
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ1302
- 2 Database:dbAMP dbAMP_03235
- 3 Database:DRAMP DRAMP03737
- 4 Database:Uniprot Q5VJS9
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A002451 From 1 To 44 E-value: 2e-19 Score: 86.3
GKVWDWIKKTAKDVLNSDVAKQLKNKALNAAKNFVAEKIGATPS - 2. L12A08779| From 24 To 65 E-value: 0.000000000000004 Score: 71.6
VWDWLKKTAKNVWNSDIVKQLKGKAINAAKNYVAEKIGATPS - 3. L13A011887 From 2 To 43 E-value: 0.000000000000008 Score: 70.9
VWDWLKKTAKNVWNSDIVKQLKGKAINAAKNYVAEKIGATPS - 4. L01A000338 From 1 To 44 E-value: 0.00000000000002 Score: 69.7
GKVWDWIKSTAKKLWNSEPVKELKNTALNAAKNFVAEKIGATPS - 5. L12A08840| From 23 To 66 E-value: 0.00000000000004 Score: 68.6
GKVWDWIKSTAKKLWNSEPVKELKNTALNAAKNLVAEKIGATPS
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
No references found on LAMP database
Comments
- Comments
No comments found on LAMP database