Record in detail


General Info

  • lamp_id:L01A002457
  • Name:[33300590]beta defensin 39 [Mus musculus]
  • FullName:[33300590]beta defensin 39 [Mus musculus]
  • Source:Mus musculus (house mouse)
  • Mass:4248.7 Da
  • Sequence Length:36 aa
  • Isoelectric Point:7.03
  • Activity:Antibacterial
  • Sequence
        DSIQCFQKNNTCHTNQCPYFQDEIGTCYDRRGKCCQ
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF191    From 25 To 60 E-value: 8e-17 Score: 77.4
        DSIQCFQKNNTCHTNQCPYFQDEIGTCYDKRGKCCQ
  • 2. L01A002611    From 2 To 37 E-value: 1e-16 Score: 76.6
        DSIQCFQKNNTCHTNQCPYFQDEIGTCYDKRGKCCQ
  • 3. L01A002457    From 1 To 36 E-value: 2e-16 Score: 76.6
        DSIQCFQKNNTCHTNQCPYFQDEIGTCYDRRGKCCQ
  • 4. L01A003607    From 2 To 37 E-value: 0.00000000000005 Score: 68.2
        DSVKCFQKNNTCHTIRCPYFQDEVGTCYEGRGKCCQ
  • 5. L03A000152    From 25 To 60 E-value: 0.00000003 Score: 48.9
        DTIKCLQGNNNCHIQKCPWFLLQVSTCYKGKGRCCQ

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: