Record in detail


General Info

  • lamp_id:L01A002462
  • Name:[149930885]putative antimicrobial peptide A Pacific variant [Ciona intestinalis]
  • FullName:[149930885]putative antimicrobial peptide A Pacific variant [Ciona intestinalis]
  • Source:Ciona intestinalis
  • Mass:8393.4 Da
  • Sequence Length:73 aa
  • Isoelectric Point:9.15
  • Activity:Antimicrobial
  • Sequence
        ALRSAVRTVARVGRAVLPHVAIADPYVRTPYVHNNPDWSLWRRKRWNQQPTSQADMLEDALEAQAIEALMQEQ
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002462    From 1 To 73 E-value: 2e-38 Score: 149
        ALRSAVRTVARVGRAVLPHVAIADPYVRTPYVHNNPDWSLWRRKRWNQQPTSQADMLEDALEAQAIEALMQEQ
  • 2. L01A002463    From 1 To 75 E-value: 8e-32 Score: 127
        ALRGALRAVARVGKAILPHVAIANPYVRTPYVHNNPDWSLWRSRRRSGNQQPTSQAEILEDALEAQAIEALMQEQ
  • 3. L01A000183    From 2 To 37 E-value: 0.00000000000009 Score: 67.4
        ALRGALRAVARVGKAILPHVAIANPYVRTPYVHNNP
  • 4. L13A022713    From 1 To 22 E-value: 0.000001 Score: 43.1
        ALRSAVRTVARVGRAVLPHVAI

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: