Record in detail


General Info

  • lamp_id:L01A002463
  • Name:[149930883]putative antimicrobial peptide A Northern Europe Heligoland variant [Ciona intestinalis]
  • FullName:[149930883]putative antimicrobial peptide A Northern Europe Heligoland variant [Ciona intestinalis]
  • Source:Ciona intestinalis
  • Mass:8401.4 Da
  • Sequence Length:75 aa
  • Isoelectric Point:10
  • Activity:Antimicrobial
  • Sequence
        ALRGALRAVARVGKAILPHVAIANPYVRTPYVHNNPDWSLWRSRRRSGNQQPTSQAEILEDALEAQAIEALMQEQ
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002463    From 1 To 75 E-value: 2e-39 Score: 152
        ALRGALRAVARVGKAILPHVAIANPYVRTPYVHNNPDWSLWRSRRRSGNQQPTSQAEILEDALEAQAIEALMQEQ
  • 2. L01A002462    From 1 To 73 E-value: 9e-32 Score: 127
        ALRSAVRTVARVGRAVLPHVAIADPYVRTPYVHNNPDWSLW--RRKRWNQQPTSQADMLEDALEAQAIEALMQEQ
  • 3. L01A000183    From 2 To 37 E-value: 5e-16 Score: 75.1
        ALRGALRAVARVGKAILPHVAIANPYVRTPYVHNNP
  • 4. L13A022713    From 1 To 22 E-value: 0.0002 Score: 36.6
        ALRSAVRTVARVGRAVLPHVAI
  • 5. L12A06177|    From 49 To 67 E-value: 1.2 Score: 23.9
        RGLLSVLGSVAKHVLPHVV

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: