Record in detail


General Info

  • lamp_id:L01A002464
  • Name:antimicrobial amphipathic helix-forming peptide
  • FullName:antimicrobial amphipathic helix-forming peptide
  • Source:Xenopus laevis (African clawed frog)
  • Mass:7235.6 Da
  • Sequence Length:66 aa
  • Isoelectric Point:8.6
  • Activity:Antibacterial
  • Sequence
        LKCVNLQANGIKMTQECAKEDTKCLTLRSLKKTLKFCASGRTCTTMKIMSLPGEQITCCEGNMCNA
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002464    From 1 To 66 E-value: 3e-33 Score: 132
        LKCVNLQANGIKMTQECAKEDTKCLTLRSLKKTLKFCASGRTCTTMKIMSLPGEQITCCEGNMCNA
  • 2. L12A00538|    From 1 To 49 E-value: 0.48 Score: 25
        ARSFISNDECPSEHYHCRLKCNADEHAIRYCADFSICCKLKIIEIDGQK
  • 3. L12A00539|    From 1 To 49 E-value: 0.8 Score: 24.3
        ARSFISNDECPSEYYHCRLKCNADEHAIRYCADFSICCKLKIIEIDGQK
  • 4. L01A003518    From 4 To 46 E-value: 0.8 Score: 24.3
        NDECPSEYYHCRLKCNADEHAIRYCADFSICCKLKIIEIDGQK
  • 5. L12A02367|    From 4 To 46 E-value: 1 Score: 23.9
        NDECPSEYYHCRLKCNADEHAIRYCADFSICCKLKIIQIDGQK

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: