Record in detail


General Info

  • lamp_id:L01A002475
  • Name:DFB37_MOUSE
  • FullName:Beta-defensin 37
  • Source:Mus musculus
  • Mass:4023.6 Da
  • Sequence Length:36 aa
  • Isoelectric Point:8.12
  • Activity:Antimicrobial
  • Sequence
        DTIACIENKDTCRLKNCPRLHNVVGTCYEGKGKCCH
  • Function:Has antibacterial activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF187    From 25 To 60 E-value: 3e-17 Score: 79
        DTIACIENKDTCRLKNCPRLHNVVGTCYEGKGKCCH
  • 2. L01A002475    From 1 To 36 E-value: 2e-16 Score: 75.9
        DTIACIENKDTCRLKNCPRLHNVVGTCYEGKGKCCH
  • 3. L05ADEF324    From 25 To 60 E-value: 0.00000001 Score: 50.4
        DTRVCIEKRNTCHILQCPLFRDVVGTCFEGIGKCCH
  • 4. L12A07933|    From 25 To 60 E-value: 0.0000004 Score: 45.4
        DTKKCVQRKNACHYFECPWLYYSVGTCYKGKGKCCQ
  • 5. L01A000632    From 4 To 39 E-value: 0.0000006 Score: 44.7
        DTKKCVQRKNACHYFECPWLYYSVGTCYKGKGKCCQ

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Marquez G.,Martinez-A C.,Albar J.P.,Villares R.,Zaballos A.,
  •   Title:Identification on mouse chromosome 8 of new beta-defensin genes with regionally specific expression in the male reproductive organ.
  •   Journal:J. Biol. Chem., 2004, 279, 12421-12426  [PubMed:14718547]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: