Record in detail


General Info

  • lamp_id:L01A002476
  • Name:DFB10_MOUSE
  • FullName:Beta-defensin 10
  • Source:Mus musculus
  • Mass:5891.9 Da
  • Sequence Length:50 aa
  • Isoelectric Point:9.15
  • Activity:Antimicrobial
  • Sequence
        DLKHLILKAQLTRCYKFGGFCHYNICPGNSRFMSNCHPENLRCCKNIKQF
  • Function:Has antibacterial activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF161    From 24 To 73 E-value: 1e-25 Score: 107
        DLKHLILKAQLTRCYKFGGFCHYNICPGNSRFMSNCHPENLRCCKNIKQF
  • 2. L01A002476    From 1 To 50 E-value: 2e-25 Score: 105
        DLKHLILKAQLTRCYKFGGFCHYNICPGNSRFMSNCHPENLRCCKNIKQF
  • 3. L05ADEF162    From 24 To 73 E-value: 2e-16 Score: 75.9
        DLKHLILKAQLARCYKFGGFCYNSMCPPHTKFIGNCHPDHLHCCINMKEL
  • 4. L01A002495    From 1 To 50 E-value: 4e-16 Score: 75.1
        DLKHLILKAQLARCYKFGGFCYNSMCPPHTKFIGNCHPDHLHCCINMKEL
  • 5. L01A003678    From 1 To 46 E-value: 0.0000004 Score: 45.4
        ELKHLGMTAETEWCRLFEGFCHDKNCPPPTSHVGSCHPEKRSCCKD

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Dorin J.R.,Hill R.E.,Kilanowski F.M.,Semple C.A.M.,Morrison G.M.,
  •   Title:Signal sequence conservation and mature peptide divergence within subgroups of the murine beta-defensin gene family.
  •   Journal:Mol. Biol. Evol., 2003, 20, 460-470  [PubMed:12644567]
  •   [2]  Goldstein S.,Zody M.C.,Hillier L.W.,Goodstadt L.,Church D.M.,
  •   Title:Lineage-specific biology revealed by a finished genome assembly of the mouse.
  •   Journal:PLoS Biol., 2009, 7, 0-0  [PubMed:19468303]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: