Record in detail


General Info

  • lamp_id:L01A002480
  • Name:b-defensin2-like protein 1
  • FullName:b-defensin2-like protein 1
  • Source:Macaca mulatta (rhesus monkey)
  • Mass:3889.7 Da
  • Sequence Length:36 aa
  • Isoelectric Point:9.21
  • Activity:Antimicrobial
  • Sequence
        NPVTCLRSGAICHPGFCPRRYKHIGICGVSAIKCCK
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000187    From 27 To 62 E-value: 5e-16 Score: 74.7
        NPVTCLRSGAICHPGFCPRRYKHIGVCGVSAIKCCK
  • 2. L01A002480    From 1 To 36 E-value: 6e-16 Score: 74.7
        NPVTCLRSGAICHPGFCPRRYKHIGICGVSAIKCCK
  • 3. L01A002478    From 1 To 36 E-value: 8e-16 Score: 74.3
        NPVTCLRSGAICHPGFCPRRYKHIGVCGVSAIKCCK
  • 4. L01A002539    From 1 To 36 E-value: 0.000000000000009 Score: 70.5
        NPVTCLRSGAICHPGFCPRRYKHIGTCGLSVIKCCK
  • 5. L03A000188    From 27 To 62 E-value: 0.00000000000001 Score: 70.5
        NPVTCVRSGAICLPGFCPRRYKHIGVCGVSAIKCCK

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: