Record in detail


General Info

  • lamp_id:L01A002483
  • Name:dermaseptin S13
  • FullName:dermaseptin S13
  • Source:Phyllomedusa sauvagii (painted-belly leaf frog)
  • Mass:5844.3 Da
  • Sequence Length:51 aa
  • Isoelectric Point:4.17
  • Activity:Antimicrobial
  • Sequence
        DEEKRENEDEENQEDDEQSEMRRGLRSKIKEAAKTAGKMALGFVNDMAGEQ
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002483    From 1 To 51 E-value: 2e-23 Score: 99.8
        DEEKRENEDEENQEDDEQSEMRRGLRSKIKEAAKTAGKMALGFVNDMAGEQ
  • 2. L01A002484    From 19 To 51 E-value: 0.000000000001 Score: 63.5
        SEMRRGLWSKIKEAAKTAGKMAMGFVNDMVGEQ
  • 3. L13A016237    From 1 To 28 E-value: 0.00000000004 Score: 58.2
        GLRSKIKEAAKTAGKMALGFVNDMAGEQ
  • 4. L02A000941    From 1 To 25 E-value: 0.000000002 Score: 52.4
        GLRSKIKEAAKTAGKMALGFVNDMA
  • 5. L02A000940    From 1 To 25 E-value: 0.00000006 Score: 48.1
        GLWSKIKEAAKTAGKMAMGFVNDMV

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: