Record in detail


General Info

  • lamp_id:L01A002485
  • Name:dermaseptin S11
  • FullName:dermaseptin S11
  • Source:Phyllomedusa sauvagii (painted-belly leaf frog)
  • Mass:6104.5 Da
  • Sequence Length:53 aa
  • Isoelectric Point:4.2
  • Activity:Antimicrobial
  • Sequence
        EEEKRENEDEEEQEDDEQSEEKRALWKTLLKGAGKVFGHVAKQFLGSQGQPES
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002485    From 1 To 53 E-value: 1e-24 Score: 103
        EEEKRENEDEEEQEDDEQSEEKRALWKTLLKGAGKVFGHVAKQFLGSQGQPES
  • 2. L02A000939    From 1 To 30 E-value: 0.0000000000007 Score: 64.3
        ALWKTLLKGAGKVFGHVAKQFLGSQGQPES
  • 3. L13A019479    From 1 To 30 E-value: 0.0000000003 Score: 55.5
        GLFKTLIKGAGKMLGHVAKQFLGSQGQPES
  • 4. L12A06197|    From 44 To 75 E-value: 0.000000001 Score: 53.9
        KRALWKTIIKGAGKMIGSLAKNLLGSQAQPES
  • 5. L03A000085    From 44 To 75 E-value: 0.000000001 Score: 53.5
        KRALWKTIIKGAGKMIGSLAKNLLGSQAQPES

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: