Record in detail


General Info

  • lamp_id:L01A002487
  • Name:dermaseptin S9
  • FullName:dermaseptin S9
  • Source:Phyllomedusa sauvagii (painted-belly leaf frog)
  • Mass:5957.6 Da
  • Sequence Length:47 aa
  • Isoelectric Point:4.32
  • Activity:Antimicrobial
  • Sequence
        DEEKRENEDEENQEDDEQSEMRRGLRSKIWLWVLLMIWQESNKFKKM
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002487    From 1 To 47 E-value: 5e-21 Score: 91.3
        DEEKRENEDEENQEDDEQSEMRRGLRSKIWLWVLLMIWQESNKFKKM
  • 2. L02A000764    From 1 To 24 E-value: 0.000000007 Score: 51.2
        GLRSKIWLWVLLMIWQESNKFKKM
  • 3. L13A015306    From 1 To 24 E-value: 0.00000004 Score: 48.5
        GLRSRIWLWVLLMIWQESNRFKRM
  • 4. L12A06203|    From 35 To 51 E-value: 0.024 Score: 29.3
        QEDDEQSEMKRGLWSTI
  • 5. L12A07029|    From 23 To 44 E-value: 0.24 Score: 26.2
        EQERNADEDEESEIKRGIFPKI

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: