Record in detail


General Info

  • lamp_id:L01A002488
  • Name:TPA_exp: EP2E protein
  • FullName:TPA_exp: EP2E protein
  • Source:Sus scrofa (pig)
  • Mass:4103.7 Da
  • Sequence Length:35 aa
  • Isoelectric Point:7.78
  • Activity:Antimicrobial
  • Sequence
        RDVICLMQHGTCRLFFCHSGEKKSEICSDPWNRCC
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002488    From 1 To 35 E-value: 2e-16 Score: 76.3
        RDVICLMQHGTCRLFFCHSGEKKSEICSDPWNRCC
  • 2. L12A08375|    From 26 To 60 E-value: 0.000000000000001 Score: 73.2
        RNIICLMQHGTCRLFFCRSGEKKSEICSDPWNRCC
  • 3. L01A000037    From 1 To 35 E-value: 0.000000000000004 Score: 71.6
        RNIICLMQHGTCRLFFCRSGEKKSEICSDPWNRCC
  • 4. L01A002570    From 1 To 35 E-value: 0.00000000000001 Score: 70.1
        RDVICLTQHGTCRLFFCHFGERKAEICSDPWNRCC
  • 5. L01A000195    From 8 To 42 E-value: 0.00000000000002 Score: 69.3
        RNTICLMQQGTCRLFFCHSGEKKRDICSDPWNRCC

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: