Record in detail


General Info

  • lamp_id:L01A002492
  • Name:cryptdin related sequence peptide
  • FullName:cryptdin related sequence peptide
  • Source:Mus musculus (house mouse)
  • Mass:4261 Da
  • Sequence Length:38 aa
  • Isoelectric Point:8.68
  • Activity:Antibacterial
  • Sequence
        LQDAALGWSRRCPRCPPCPNCRRCPRCPTCPSCNCNPK
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002492    From 1 To 38 E-value: 0.000000000000002 Score: 72.8
        LQDAALGWSRRCPRCPPCPNCRRCPRCPTCPSCNCNPK
  • 2. L02A001631    From 1 To 38 E-value: 0.00000006 Score: 48.1
        LQDAALGWGRRCPRCPRCPNCKRCPRCPTCPRCNCNPK
  • 3. L03A000157    From 54 To 91 E-value: 0.000001 Score: 43.5
        LQDAAIRRARRCPPCPSCLSCPWCPRCLRCPMCKCNPK
  • 4. L01A002606    From 1 To 38 E-value: 0.000005 Score: 41.6
        LQDAALGWGRRCPRCPPCPRCSWCPRCPTCPGCNCNPK
  • 5. L02A001627    From 1 To 38 E-value: 0.00001 Score: 40.4
        LQDAALGWGRRCPRCPRCPRCSWCPRCPTCPRCNCNPK

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: