Record in detail


General Info

  • lamp_id:L01A002498
  • Name:unnamed protein product
  • FullName:unnamed protein product
  • Source:synthetic construct
  • Mass:4821.5 Da
  • Sequence Length:41 aa
  • Isoelectric Point:8.89
  • Activity:Antimicrobial
  • Sequence
        SLDKRACNFQSCWATCQAQHSIYFRRAFCDRSQCKCVFVRG
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002498    From 1 To 41 E-value: 4e-19 Score: 85.1
        SLDKRACNFQSCWATCQAQHSIYFRRAFCDRSQCKCVFVRG
  • 2. L01A000154    From 1 To 36 E-value: 3e-16 Score: 75.5
        ACNFQSCWATCQAQHSIYFRRAFCDRSQCKCVFVRG
  • 3. L05ADEF431    From 1 To 36 E-value: 0.0000000002 Score: 56.6
        ACDFQSCWVTCQRQHSIYFIRAFCDGSRCMCVYNNG
  • 4. L05ADEF425    From 1 To 35 E-value: 0.0000000003 Score: 55.5
        ACDFNSCWATCKAQNGIYFRRAFCDGPTCLCVFLN
  • 5. L05ADEF434    From 1 To 35 E-value: 0.0000000007 Score: 54.7
        ACDFHSCWATCQAQHGICFRRAYCDGPSCQCVFLN

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: