Record in detail


General Info

  • lamp_id:L01A002499
  • Name:Human beta defensin 2; G26M hBD-2
  • FullName:Human beta defensin 2; G26M hBD-2
  • Source:Homo sapiens (Human)
  • Mass:4204.1 Da
  • Sequence Length:39 aa
  • Isoelectric Point:9.19
  • Activity:Antibacterial
  • Sequence
        DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPP
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001370    From 27 To 64 E-value: 1e-17 Score: 80.1
        DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
  • 2. L01A002499    From 1 To 39 E-value: 1e-17 Score: 80.1
        DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPP
  • 3. L01A001369    From 27 To 64 E-value: 1e-17 Score: 80.1
        DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
  • 4. L07APD0048    From 1 To 38 E-value: 4e-17 Score: 78.6
        DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
  • 5. L01A003038    From 4 To 41 E-value: 4e-17 Score: 78.6
        DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  E.coli D31  MIC:  62 μg/ml  (14.7475 μM)  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: