Record in detail


General Info

  • lamp_id:L01A002500
  • Name:PREDICTED: sperm associated antigen 11A
  • FullName:PREDICTED: sperm associated antigen 11A
  • Source:Homo sapiens (Human)
  • Mass:3748.2 Da
  • Sequence Length:32 aa
  • Isoelectric Point:6.22
  • Activity:Antimicrobial
  • Sequence
        VDCRRSEGFCQEYCNYMETQVGYCSKKKDACC
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002500    From 1 To 32 E-value: 0.0000000000001 Score: 67.4
        VDCRRSEGFCQEYCNYMETQVGYCSKKKDACC
  • 2. L01A000194    From 20 To 51 E-value: 0.0000000000001 Score: 66.6
        VDCKRSEGFCQEYCNYLETQVGYCSKKKDACC
  • 3. L01A002432    From 20 To 51 E-value: 0.0000000000003 Score: 65.9
        VDFRRSEGFCQEYCNYMETQVGYCPKKKDACC
  • 4. L01A002596    From 3 To 34 E-value: 0.0000000000004 Score: 65.1
        VDCKRSEGFCQEYCNYLETQVGYCSKKKDACC
  • 5. L01A002555    From 3 To 34 E-value: 0.00000000004 Score: 58.5
        VNCKKNEGFCQKYCNFMETQVGYCSKKKEACC

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: