Record in detail


General Info

  • lamp_id:L01A002505
  • Name:beta-defensin 127
  • FullName:beta-defensin 127
  • Source:Canis lupus familiaris (dog )
  • Mass:6941.1 Da
  • Sequence Length:58 aa
  • Isoelectric Point:8.85
  • Activity:Antimicrobial
  • Sequence
        KVTEQLKRCWGEYIRGYCRKICRISEIREVLCENGRYCCLNIVELEARRKITKPPPPE
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002505    From 1 To 58 E-value: 2e-28 Score: 115
        KVTEQLKRCWGEYIRGYCRKICRISEIREVLCENGRYCCLNIVELEARRKITKPPPPE
  • 2. L12A10171|    From 1 To 54 E-value: 4e-27 Score: 111
        QLKRCWGEYIRGYCRKICRISEIREVLCENGRYCCLNIVELEARRKITKPPPPE
  • 3. L12A05830|    From 8 To 64 E-value: 3e-25 Score: 105
        VTEHLKRCWGEYIQGYCRKICRISEIRQVLCENGRYCCLNIMELEARRKITKPTRPK
  • 4. L12A04493|    From 1 To 54 E-value: 1e-23 Score: 99.8
        HLKRCWGEYIQGYCRKICRISEIRQVLCENGRYCCLNIMELEARRKITKPTRPK
  • 5. L12A01518|    From 1 To 55 E-value: 6e-22 Score: 94.4
        EQLKRCWNQYIQGYCRKICRTTEVREVLCENGRYCCINLAELEERKKITKPPRPK

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: